PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G02460.1
Common NameDOF5.1, T1E22.3, T22P11_50
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 399aa    MW: 42530.8 Da    PI: 9.177
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G02460.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof121.33.5e-3892151362
       zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                  e+alkcprCdstntkfCy+nnysl+qPr+fCkaCrryWt+GGalr vPvGgg+r+nk+++
  AT5G02460.1  92 ETALKCPRCDSTNTKFCYFNNYSLTQPRHFCKACRRYWTRGGALRSVPVGGGCRRNKRTK 151
                  6789*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3975149IPR003851Zinc finger, Dof-type
PfamPF027014.0E-3294149IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.39495149IPR003851Zinc finger, Dof-type
PROSITE patternPS01361097133IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 399 aa     Download sequence    Send to blast
MVFSSFPTYP DHSSNWQQQH QPITTTVGFT GNNINQQFLP HHPLPPQQQQ TPPQLHHNNG  60
NGGVAVPGGP GGLIRPGSMA ERARLANIPL PETALKCPRC DSTNTKFCYF NNYSLTQPRH  120
FCKACRRYWT RGGALRSVPV GGGCRRNKRT KNSSGGGGGS TSSGNSKSQD SATSNDQYHH  180
RAMANNQMGP PSSSSSLSSL LSSYNAGLIP GHDHNSNNNN ILGLGSSLPP LKLMPPLDFT  240
DNFTLQYGAV SAPSYHIGGG SSGGAAALLN GFDQWRFPAT NQLPLGGLDP FDQQHQMEQQ  300
NPGYGLVTGS GQYRPKNIFH NLISSSSSAS SAMVTATASQ LASVKMEDSN NQLNLSRQLF  360
GDEQQLWNIH GAAAASTAAA TSSWSEVSNN FSSSSTSNI
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.334120.0flower| silique
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1453575490.0
Genevisible251051_at0.0
Expression AtlasAT5G02460-
AtGenExpressAT5G02460-
ATTED-IIAT5G02460-
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. Dof5.1 protein regulates leaf adaxial-abaxial polarity by controlling REV expression.
    [PMID: 20807212]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00483DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G02460.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G02460
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4937310.0AB493731.1 Arabidopsis thaliana At5g02460 mRNA for hypothetical protein, partial cds, clone: RAAt5g02460.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_195866.10.0Dof zinc finger protein DOF5.1
SwissprotQ9LZ560.0DOF51_ARATH; Dof zinc finger protein DOF5.1
TrEMBLC0SVM80.0C0SVM8_ARATH; Putative uncharacterized protein At5g02460 (Fragment)
STRINGAT5G02460.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM115191732
Representative plantOGRP3817445
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Yanagisawa S
    The Dof family of plant transcription factors.
    Trends Plant Sci., 2002. 7(12): p. 555-60
    [PMID:12475498]
  3. Lijavetzky D,Carbonero P,Vicente-Carbajosa J
    Genome-wide comparative phylogenetic analysis of the rice and Arabidopsis Dof gene families.
    BMC Evol. Biol., 2003. 3: p. 17
    [PMID:12877745]
  4. Castelli V, et al.
    Whole genome sequence comparisons and "full-length" cDNA sequences: a combined approach to evaluate and improve Arabidopsis genome annotation.
    Genome Res., 2004. 14(3): p. 406-13
    [PMID:14993207]
  5. Kim HS, et al.
    The DOF transcription factor Dof5.1 influences leaf axial patterning by promoting Revoluta transcription in Arabidopsis.
    Plant J., 2010. 64(3): p. 524-35
    [PMID:20807212]
  6. Meinke DW
    A survey of dominant mutations in Arabidopsis thaliana.
    Trends Plant Sci., 2013. 18(2): p. 84-91
    [PMID:22995285]